PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0451s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 743aa    MW: 83086.8 Da    PI: 5.4021
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0451s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.81.2e-1183687391374
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lL+ cA+av+++d + a+ lL+++++++ p+gd+mq la  f+ +L+arla+s++++ykal +++ts    +++l+a+++f  +
  SapurV1A.0451s0060.1.p 368 LRTLLTLCAQAVAADDRRSANDLLKQIRQNSPPTGDAMQSLANIFADGLEARLAGSGTQIYKALISKPTS---AADVLKAYHMFLAA 451
                             5789**************************************************************9999...9************* PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                             +P+ k+s++  N++I++ +e++++vHi+Df+i +G+QWp+L+q L+sRp+gpp+lRiTg++ p++g   +e++eetg+rLa++A+++
  SapurV1A.0451s0060.1.p 452 CPFRKLSNFFSNKTIMNIAENATKVHIVDFGILYGFQWPCLIQRLSSRPGGPPHLRITGIDLPNPGfrPAERVEETGRRLANYANTF 538
                             *****************************************************************9********************* PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                             +vpfef++ +a++++++++e+L+++++E+l+Vn+ ++l +llde+v +es+r+ vL+l+++++P+v++    +  +n++ F +rf e
  SapurV1A.0451s0060.1.p 539 KVPFEFKA-IAQKWDTIKIEDLKIDRNEVLVVNSLYRLRNLLDETVVVESPRNIVLNLIRNMNPDVFIQGVVNGAYNAPFFITRFRE 624
                             ********.7***************************************************************************** PP

                    GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                             al ++s+lfd lea+++re  er+ +Ere++g+e++nv+acegaer+er et+++W++++ +aGF+++pl+++++++ak  ++  + 
  SapurV1A.0451s0060.1.p 625 ALFHFSTLFDVLEANVSREVPERMLIEREIFGWEAMNVIACEGAERIERPETYKQWQMWILRAGFRQLPLNQEIYMTAKEKVEARYH 711
                             ************************************************************************************998 PP

                    GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                             + + ++e+s++l++gWk+r ++++S+W+
  SapurV1A.0451s0060.1.p 712 KDFVIDEDSHWLLQGWKGRIVYALSSWK 739
                             88*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.092342719IPR005202Transcription factor GRAS
PfamPF035144.2E-116368739IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MIMDPSLRGL YGSVNGLKLS NETQFASLDQ DLVNVLKLDS SCVNQNYVNS PLVPHDSIPS  60
SSVLSASMIQ EGDSLEDFDF SDVVLKYISK MLMEEEMEEK TCMFQESSVA LLAAEKSLYE  120
LIGEKHPSAP DDPVQCLDRN HERPDENHDL NCSNYTSSTS SSSSSNLVDH EWTGDLGEYK  180
SSRHASQSSY SPGNSSTSAD GFVDSPVSPN MVAEIFRESE SVMQFKKGFE EASKFIPNGN  240
LFINLESKGM FLQDLKEDVN DVLAMAGVKR ENYNYEDGLR GKKNPYPEES TLEGSRSNKQ  300
SAVYSGSTAS PEDFDRVLLN CGKDVSALQA PVHIGESKSV QKNGQAKGSN GGKARGKRQG  360
GKKNVVDLRT LLTLCAQAVA ADDRRSANDL LKQIRQNSPP TGDAMQSLAN IFADGLEARL  420
AGSGTQIYKA LISKPTSAAD VLKAYHMFLA ACPFRKLSNF FSNKTIMNIA ENATKVHIVD  480
FGILYGFQWP CLIQRLSSRP GGPPHLRITG IDLPNPGFRP AERVEETGRR LANYANTFKV  540
PFEFKAIAQK WDTIKIEDLK IDRNEVLVVN SLYRLRNLLD ETVVVESPRN IVLNLIRNMN  600
PDVFIQGVVN GAYNAPFFIT RFREALFHFS TLFDVLEANV SREVPERMLI EREIFGWEAM  660
NVIACEGAER IERPETYKQW QMWILRAGFR QLPLNQEIYM TAKEKVEARY HKDFVIDEDS  720
HWLLQGWKGR IVYALSSWKP DC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-473687395375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311175.20.0hypothetical protein POPTR_0008s05750g
RefseqXP_006379601.10.0hypothetical protein POPTR_0008s05750g
TrEMBLB9HMJ20.0B9HMJ2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s05750.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein